Product Added to your Cart
x

-------- OR --------

FREE DELIVERY on all orders over £40
UK Shipping England, Scotland, Wales & N.Ireland, Isle of Man & Isles of Scilly
(excluding Highlands & Islands)

DAILY TOP PICKS

English - British
DenmarkEnglish - AmericanGermanyItalySpainFinlandFrance
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Menu
0 items
Witchy Kitchen & Drinkware

Discover Witchy Kitchen & Drinkware at Ceridwen Mystics, where gothic style meets magical everyday living. Shop witchy mugs, mystical cups, enchanted glasses, occult-inspired kitchen accessories and pagan drinkware for tea, coffee and cocktails. Perfect for spiritual homes, alternative interiors and gifts for witches, pagans and lovers of dark, mystical décor.

Sub-Categories
Mugs & CrockeryCooking & BakingWitchy
33 product(s) found for "Witchy Kitchen & Drinkware"
ACDC Logo Shot Glass Set (Se..
Mugs & Crockery
ACDC Logo Shot Glass Set (Se..
Raise a glass to legendary rock n roll with the ACDC Logo Shot Glass Set, a striking collection of three shot glasses created for fans of AC/DC, classic rock, heavy metal, and iconic music memorabilia....
£69.99
Units in Stock: 2
£69.99
Details
Add To Cart
Raise a glass to legendary rock n roll with the ACDC Logo Shot Glass Set, a striking collection of three shot glasses created for fans of AC/DC, classic rock, heavy metal, and iconic music memorabilia....
Astrology Zodiac Wheel Colou..
Mugs & Crockery
Astrology Zodiac Wheel Colou..
Explore the magic of the zodiac with the Astrology Zodiac Wheel Colour Changing Coffee Mug from Ceridwen Mystics. Designed for astrology lovers, spiritual seekers and fans of mystical homeware, this enchanting...
£9.89
Units in Stock: 4
£9.89
Details
Add To Cart
Explore the magic of the zodiac with the Astrology Zodiac Wheel Colour Changing Coffee Mug from Ceridwen Mystics. Designed for astrology lovers, spiritual seekers and fans of mystical homeware, this enchanting...
Autumn Leaves and Pumpkins F..
Mugs & Crockery
Autumn Leaves and Pumpkins F..
Autumn Leaves and Pumpkins Mug Embrace the cozy vibes of the season with our Autumn Leaves and Pumpkins Mug . This delightful mug is perfect for sipping your favourite tea , coffee , or even a rich hot...
£10.99
Units in Stock: 2
£10.99
Details
Add To Cart
Autumn Leaves and Pumpkins Mug Embrace the cozy vibes of the season with our Autumn Leaves and Pumpkins Mug . This delightful mug is perfect for sipping your favourite tea , coffee , or even a rich hot...
Black and White Striped Cera..
Mugs & Crockery
Black and White Striped Cera..
Black and White Striped Pumpkin Teapot Introducing our charming Black and White Striped Pumpkin Teapot , the perfect blend of whimsy and elegance for your tea time! This delightful teapot is designed to...
£24.99
Units in Stock: 10
£24.99
Details
Add To Cart
Black and White Striped Pumpkin Teapot Introducing our charming Black and White Striped Pumpkin Teapot , the perfect blend of whimsy and elegance for your tea time! This delightful teapot is designed to...
Black Cauldron Witch Mug for..
Mugs & Crockery
Black Cauldron Witch Mug for..
This brilliant black mug is designed to look like a cauldron, perfect for anyone who likes to channel their inner witch. The mug will come in a matching cardboard box. Suitable for microwave or dishwasher...
£12.99
Units in Stock: 5
£12.99
Details
Add To Cart
This brilliant black mug is designed to look like a cauldron, perfect for anyone who likes to channel their inner witch. The mug will come in a matching cardboard box. Suitable for microwave or dishwasher...
Blood Of My Enemies Stemless..
Mugs & Crockery
Blood Of My Enemies Stemless..
A unique gift for that special someone who enjoys a good laugh with their wine! This eye-catching glass is not just a drinking vessel; it s a statement piece that showcases your bold personality and sense...
£12.99
Units in Stock: 0
£12.99
Details
Add To Cart
A unique gift for that special someone who enjoys a good laugh with their wine! This eye-catching glass is not just a drinking vessel; it s a statement piece that showcases your bold personality and sense...
Crystal Witch Print Mug
Mugs & Crockery
Crystal Witch Print Mug
Bring a touch of mystical style to your daily rituals with the Crystal Witch Print Mug from Ceridwen Mystics. Designed for crystal lovers, witches, spiritual seekers and fans of alternative homeware, this...
£8.99
Units in Stock: 5
£8.99
Details
Add To Cart
Bring a touch of mystical style to your daily rituals with the Crystal Witch Print Mug from Ceridwen Mystics. Designed for crystal lovers, witches, spiritual seekers and fans of alternative homeware, this...
Crystal Witch Print Stemless..
Mugs & Crockery
Crystal Witch Print Stemless..
Bring a mystical charm to every toast with the Crystal Witch Print Stemless Glass from Ceridwen Mystics. Designed for lovers of witchy décor, crystal magic and alternative living, this stemless glass combines...
£10.99
Units in Stock: 3
£10.99
Details
Add To Cart
Bring a mystical charm to every toast with the Crystal Witch Print Stemless Glass from Ceridwen Mystics. Designed for lovers of witchy décor, crystal magic and alternative living, this stemless glass combines...
D20 Gaming Dice Shaped Mug
Mugs & Crockery
D20 Gaming Dice Shaped Mug
Are you a tabletop gaming enthusiast who loves to sip your favourite beverage while rolling those critical hits? Look no further than our D20 Gaming Dice Shaped Mug! This unique mug is not just a drinking...
£9.99
Units in Stock: 10
£9.99
Details
Add To Cart
Are you a tabletop gaming enthusiast who loves to sip your favourite beverage while rolling those critical hits? Look no further than our D20 Gaming Dice Shaped Mug! This unique mug is not just a drinking...
Dark Romance Tea Set - Two E..
Mugs & Crockery
Dark Romance Tea Set - Two E..
Black Rose Trinket Dish Cradle your cherished keepsakes in this elegant trinket tray, shaped like an unfurling black rose. A poetic accent for dressing tables and boudoirs. Product Weight: 160g Dimensions:...
£39.99
Units in Stock: 10
£39.99
Details
Add To Cart
Black Rose Trinket Dish Cradle your cherished keepsakes in this elegant trinket tray, shaped like an unfurling black rose. A poetic accent for dressing tables and boudoirs. Product Weight: 160g Dimensions:...
Dead Thirsty Cauldron Mug
Mugs & Crockery
Dead Thirsty Cauldron Mug
Get ready to brew up some fun with our Dead Thirsty Cauldron Mug! This cauldron-shaped mug is the perfect addition to your Halloween drinkware collection. Whether you're sipping on a spooky potion or just...
£10.99
Units in Stock: 200
£10.99
Details
Add To Cart
Get ready to brew up some fun with our Dead Thirsty Cauldron Mug! This cauldron-shaped mug is the perfect addition to your Halloween drinkware collection. Whether you're sipping on a spooky potion or just...
Enchanted Dark Forest Coffee..
Mugs & Crockery
Enchanted Dark Forest Coffee..
This beautifully designed mug features a stunning dark forest print that brings a touch of nature right to your kitchen. Whether you're enjoying a cozy cup of coffee in the morning or winding down with...
£8.99
Units in Stock: 10
£8.99
Details
Add To Cart
This beautifully designed mug features a stunning dark forest print that brings a touch of nature right to your kitchen. Whether you're enjoying a cozy cup of coffee in the morning or winding down with...
Jack-o'-Lantern Pumpkin Coff..
Mugs & Crockery
Jack-o'-Lantern Pumpkin Coff..
Jack-o'-Lantern Pumpkin Shaped Mug Get ready to sip in style this Halloween with our adorable Jack-o'-Lantern Pumpkin Shaped Mug ! Treat yourself to this smiling pumpkin mug and enjoy your favourite Halloween...
£8.99
Units in Stock: 1
£8.99
Details
Add To Cart
Jack-o'-Lantern Pumpkin Shaped Mug Get ready to sip in style this Halloween with our adorable Jack-o'-Lantern Pumpkin Shaped Mug ! Treat yourself to this smiling pumpkin mug and enjoy your favourite Halloween...
Keep Your Spirits Up Cute Ro..
Mugs & Crockery
Keep Your Spirits Up Cute Ro..
Sip in spooky style with this rounded ceramic mug, featuring a fun ghost design and the phrase 'Keep Your Spirits Up.' Perfect for enjoying a warm drink on chilly autumn nights or gifting to Halloween...
£10.99
Units in Stock: 2
£10.99
Details
Add To Cart
Sip in spooky style with this rounded ceramic mug, featuring a fun ghost design and the phrase 'Keep Your Spirits Up.' Perfect for enjoying a warm drink on chilly autumn nights or gifting to Halloween...
Magical Morning Potion Mug a..
Mugs & Crockery
Magical Morning Potion Mug a..
Start your day off right with our delightful Morning Potion Mug and Spoon Set! This charming set is perfect for those cozy mornings when all you need is a warm drink to kickstart your day. Whether you...
£10.99
Units in Stock: 0
£10.99
Details
Add To Cart
Start your day off right with our delightful Morning Potion Mug and Spoon Set! This charming set is perfect for those cozy mornings when all you need is a warm drink to kickstart your day. Whether you...
Make Your Own Magic Mug – In..
Mugs & Crockery
Make Your Own Magic Mug – In..
Add a little wonder to everyday moments with the Make Your Own Magic Mug, an inspirational coffee cup gift designed to bring personality and positive energy to tea breaks, coffee breaks, cosy mornings...
£14.99
Units in Stock: 10
£14.99
Details
Add To Cart
Add a little wonder to everyday moments with the Make Your Own Magic Mug, an inspirational coffee cup gift designed to bring personality and positive energy to tea breaks, coffee breaks, cosy mornings...
Moon Phase Rounded Mug
Mugs & Crockery
Moon Phase Rounded Mug
Embrace the magic of the night sky with our stunning Moon Phase Rounded Mug. Perfect for sipping your favourite hot beverages, this mug features a beautifully designed lunar motif that showcases the enchanting...
£14.99
Units in Stock: 2
£14.99
Details
Add To Cart
Embrace the magic of the night sky with our stunning Moon Phase Rounded Mug. Perfect for sipping your favourite hot beverages, this mug features a beautifully designed lunar motif that showcases the enchanting...
My Blood Type is Coffee Roun..
Mugs & Crockery
My Blood Type is Coffee Roun..
Monday mornings sucking the life out of you? Wake yourself from the dead with this rounded mug that is sure to get any vampire's blood pumping. Features text that reads 'My Blood Type is Coffee' with a...
£11.99
Units in Stock: 1
£11.99
Details
Add To Cart
Monday mornings sucking the life out of you? Wake yourself from the dead with this rounded mug that is sure to get any vampire's blood pumping. Features text that reads 'My Blood Type is Coffee' with a...
Rounded Horror Movie Coffee ..
Mugs & Crockery
Rounded Horror Movie Coffee ..
This Halloween themed mug is sure to get everyone excited for a classic scary movie! Features a flying bat and crescent moon illustration with "My Scary Movie Mug" text. With a rounded design, this will...
£14.99
Units in Stock: 1
£14.99
Details
Add To Cart
This Halloween themed mug is sure to get everyone excited for a classic scary movie! Features a flying bat and crescent moon illustration with "My Scary Movie Mug" text. With a rounded design, this will...
Set of 7 Bronze Gemstone Cry..
Witchy
Set of 7 Bronze Gemstone Cry..
Materials: Zinc Alloy, amethyst, Rose Quartz, Black Obsidian, Rock Quartz, Lapis Lazuli, Red Agate, Green Aventurine, Gemstone Dimensions: 17x13x2.5 (cm)
£19.99
Units in Stock: 2
£19.99
Details
Add To Cart
Materials: Zinc Alloy, amethyst, Rose Quartz, Black Obsidian, Rock Quartz, Lapis Lazuli, Red Agate, Green Aventurine, Gemstone Dimensions: 17x13x2.5 (cm)
Set of 7 Dark Silver Gemston..
Witchy
Set of 7 Dark Silver Gemston..
Materials: Zinc Alloy, amethyst, Rose Quartz, Black Obsidian, Rock Quartz, Lapis Lazuli, Red Agate, Green Aventurine, Gemstone Dimensions: 17x13x2.5 (cm)
£19.99
Units in Stock: 2
£19.99
Details
Add To Cart
Materials: Zinc Alloy, amethyst, Rose Quartz, Black Obsidian, Rock Quartz, Lapis Lazuli, Red Agate, Green Aventurine, Gemstone Dimensions: 17x13x2.5 (cm)
Skeleton Hand Coffee Mug for..
Mugs & Crockery
Skeleton Hand Coffee Mug for..
Add a darkly playful touch to your daily drinks with the Skeleton Hand Coffee Mug, a striking piece of gothic drinkware made for Halloween lovers, alternative homeware fans, and anyone who enjoys unusual...
£10.79
Units in Stock: 1
£10.79
Details
Add To Cart
Add a darkly playful touch to your daily drinks with the Skeleton Hand Coffee Mug, a striking piece of gothic drinkware made for Halloween lovers, alternative homeware fans, and anyone who enjoys unusual...
Stirring Up Magic Mug and Sp..
Mugs & Crockery
Stirring Up Magic Mug and Sp..
The perfect companion for your cozy winter evenings and festive gatherings! This delightful set is not just a mug; it s a magical experience that transforms your favourite hot beverages into a whimsical...
£10.99
Units in Stock: 1
£10.99
Details
Add To Cart
The perfect companion for your cozy winter evenings and festive gatherings! This delightful set is not just a mug; it s a magical experience that transforms your favourite hot beverages into a whimsical...
Strange and Unusual Gothic C..
Mugs & Crockery
Strange and Unusual Gothic C..
Bring a touch of dark character to every tea break with the Strange and Unusual Gothic Coffee Mug, a distinctive piece of unique drinkware for alternative homes, offices and creative spaces. Featuring...
£8.99
Units in Stock: 0
£8.99
Details
Add To Cart
Bring a touch of dark character to every tea break with the Strange and Unusual Gothic Coffee Mug, a distinctive piece of unique drinkware for alternative homes, offices and creative spaces. Featuring...
Striped Bundle - Storage Jar..
Mugs & Crockery
Striped Bundle - Storage Jar..
Striped Bat Storage Jar This Striped Bat Storage Jar, the perfect blend of style and functionality for your home! This eye-catching jar is designed to keep your space organised while adding a splash of...
£67.96
Units in Stock: 0
£67.96
Details
Add To Cart
Striped Bat Storage Jar This Striped Bat Storage Jar, the perfect blend of style and functionality for your home! This eye-catching jar is designed to keep your space organised while adding a splash of...
Striped Ceramic Bat Storage ..
Mugs & Crockery
Striped Ceramic Bat Storage ..
Striped Bat Storage Jar Introducing the Striped Bat Storage Jar, the perfect blend of style and functionality for your home! This eye-catching jar is designed to keep your space organised while adding...
£24.99
Units in Stock: 0
£24.99
Details
Add To Cart
Striped Bat Storage Jar Introducing the Striped Bat Storage Jar, the perfect blend of style and functionality for your home! This eye-catching jar is designed to keep your space organised while adding...
Striped Gothic Bat Wing Teac..
Mugs & Crockery
Striped Gothic Bat Wing Teac..
Take teatime to new heights with this eerily elegant tea cup with a bold bat wing handle. Designed in timeless monochrome stripes, this picture perfect piece is sure to your socials in a spin. Handwash...
£11.99
Units in Stock: 0
£11.99
Details
Add To Cart
Take teatime to new heights with this eerily elegant tea cup with a bold bat wing handle. Designed in timeless monochrome stripes, this picture perfect piece is sure to your socials in a spin. Handwash...
The Fortune Teller Tea For O..
Mugs & Crockery
The Fortune Teller Tea For O..
The perfect blend of whimsy and functionality! This delightful tea set is designed for those who appreciate the art of tea drinking and the magic of fortune telling. Whether you're enjoying a quiet afternoon...
£29.99
Units in Stock: 0
£29.99
Details
Add To Cart
The perfect blend of whimsy and functionality! This delightful tea set is designed for those who appreciate the art of tea drinking and the magic of fortune telling. Whether you're enjoying a quiet afternoon...
Venom and Vines Botanical Pr..
Mugs & Crockery
Venom and Vines Botanical Pr..
Sip in style with this beautifully designed stemless glass. Adorned with a gothic skull and poisonous botanicals design, it s perfect for wine, cocktails, or even your favourite soft drinks. A great addition...
£10.99
Units in Stock: 2
£10.99
Details
Add To Cart
Sip in style with this beautifully designed stemless glass. Adorned with a gothic skull and poisonous botanicals design, it s perfect for wine, cocktails, or even your favourite soft drinks. A great addition...
Venom and Vines Gothic Snake..
Mugs & Crockery
Venom and Vines Gothic Snake..
Get ready to sip in style with our Venom & Vines Print Mug! This unique mug is not just a drinkware item; it's a statement piece that showcases your love for all things bold and beautiful. Featuring a...
£9.99
Units in Stock: 2
£9.99
Details
Add To Cart
Get ready to sip in style with our Venom & Vines Print Mug! This unique mug is not just a drinkware item; it's a statement piece that showcases your love for all things bold and beautiful. Featuring a...
Withdraw from contract